SLC13A3/NaDC3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP160011-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP160011 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
SLC13A3/NaDC3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
hNaDC3, Na(+)/dicarboxylate cotransporter 3, NaDC-3, NADC3SDCT2naDC-3, sodium-dependent high affinity dicarboxylate transporter 3, Sodium-dependent high-affinity dicarboxylate transporter 2, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, solute carrier family 13 member 3
Host Species
Rabbit
Purification Method
Protein A purified
Regulatory Status
RUO
Gene ID (Entrez)
64849
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration
1 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Gene Accession No.
Q8WWT9
Gene Symbols
SLC13A3
Immunogen
Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the middle region of SLC13A3 (NP_001011554). Peptide sequence GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF The peptide sequence for this immunogen was taken from within the described region.
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%; Pig: 84%; Chicken: 76%; Zebrafish: 76%.
Target Species
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish
Form
Purified
Related Products
Description
- SLC13A3/NaDC3 Polyclonal specifically detects SLC13A3/NaDC3 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC13A3/NaDC3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: hNaDC3, Na(+)/dicarboxylate cotransporter 3, NaDC-3, NADC3SDCT2naDC-3, sodium-dependent high affinity dicarboxylate transporter 3, Sodium-dependent high-affinity dicarboxylate transporter 2, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, solute carrier family 13 member 3
Host Species: Rabbit
Purification Method: Protein A purified
Regulatory Status: RUO
Gene ID (Entrez): 64849
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Concentration: 1 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Gene Accession No.: Q8WWT9
Gene Symbols: SLC13A3
Immunogen: Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the middle region of SLC13A3 (NP_001011554). Peptide sequence GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF The peptide sequence for this immunogen was taken from within the described region.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%; Pig: 84%; Chicken: 76%; Zebrafish: 76%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Rabbit, Zebrafish
Form: Purified
Antigen: CML2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Camello-like protein 2, CML2, EC 2.3.1, EC 2.3.1.-, Hcml2, MGC97061, N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene), N-acetyltransferase 8B (gene/pseudogene), N-acetyltransferase Camello 2, NAT8BP, probable N-acetyltransferase 8B
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 51471
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9UHF3
Gene Symbols: NAT8B
Immunogen: Synthetic peptides corresponding to NAT8B(N-acetyltransferase 8B (gene/pseudogene)) The peptide sequence was selected from the middle region of NAT8B. Peptide sequence SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 78%.
Target Species: Human, Mouse, Rat, Porcine, Bovine, Equine, Rabbit, Yeast
Form: __
Antigen: SLC17A3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Na(+)/PI cotransporter 4, NPT4Sodium/phosphate cotransporter 4, sodium-dependent phosphate transport protein 4, solute carrier family 17 (sodium phosphate), member 3, Solute carrier family 17 member 3
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 10786
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: Q9H533
Gene Symbols: SLC17A3
Immunogen: Synthetic peptides corresponding to SLC17A3(solute carrier family 17 (sodium phosphate), member 3) The peptide sequence was selected from the middle region of SLC17A3. Peptide sequence FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS.
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 84%; Canine: 84%; Equine: 84%.
Target Species: Human, Bovine, Equine
Form: __
