MTUS1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP160099-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP160099 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
MTUS1
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias
Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Expected identity based on immunogen sequence: Xenopus: 78%.
Target Species
Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.
Q9ULD2
Gene Symbols
MTUS1
Immunogen
Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR.
Quantity
100 μL
Research Discipline
Breast Cancer
Gene ID (Entrez)
57509
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- MTUS1 Polyclonal specifically detects MTUS1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MTUS1
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Xenopus: 78%.
Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin
Gene Accession No.: Q9ULD2
Gene Symbols: MTUS1
Immunogen: Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR.
Quantity: 100 μL
Research Discipline: Breast Cancer
Gene ID (Entrez): 57509
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SERINC2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias: FKSG84, PRO0899, serine incorporator 2, TDE2, TDE2L
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
Target Species: Human
Isotype: IgG
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Accession No.: __
Gene Symbols: SERINC2
Immunogen: Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS.
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 347735
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: SERINC2
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias: FKSG84, PRO0899, serine incorporator 2, TDE2, TDE2L
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Target Species: Human
Isotype: IgG
Applications: Western Blot
Concentration: __
Dilution: Western Blot 1:100-1:2000
Gene Accession No.: __
Gene Symbols: SERINC2
Immunogen: Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS.
Quantity: 20 μL
Research Discipline: __
Gene ID (Entrez): 347735
Reconstitution: __
Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
