Manufacturer: Fischer Scientific
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP169160-Each-of-1 | In Stock | ₹ 44,455.50 |
NBP169160 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,455.50
GST (18%): ₹ 8,001.99
Total Price: ₹ 52,457.49
PPP2R2C
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
B55-GAMMA, IMYPNO1, phosphoprotein phosphatase 2A BR gamma regulatory chain, PP2A subunit B isoform B55-gamma, PP2A subunit B isoform gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, PR55G, protein phosphatase 2, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform, protein phosphatase 2, regulatory subunit B, gamma, protein phosphatase 2A1 B gamma subunit, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform
Rabbit
49 kDa
100 μL
Primary
This product is specific to Subunit or Isoform: B gamma isoform.
Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q9Y2T4
PPP2R2C
Synthetic peptides corresponding to Ppp2r2c (protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform) The peptide sequence was selected from the N terminal of Ppp2r2c. Peptide sequence VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
RUO
5522
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.