Band 3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP170433-Each-of-1 | In Stock | ₹ 41,710.50 |
NBP170433 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,710.50
GST (18%): ₹ 7,507.89
Total Price: ₹ 49,218.39
Antigen
Band 3
Classification
Polyclonal
Conjugate
Unconjugated
Formulation
PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols
SLC4A1
Immunogen
Synthetic peptides corresponding to SLC4A1 (solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)) The peptide sequence was selected from the N terminal of SLC4A1. Peptide sequence PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR The peptide sequence for this immunogen was taken from within the described region.
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
6521
Reconstitution
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications
Western Blot
Concentration
0.5 mg/ml
Dilution
Western Blot 1.0 ug/ml
Gene Alias
AE 1, AE1MGC126619, Anion exchange protein 1, Anion exchanger 1, band 3 anion transport protein, BND3, CD233, CD233 antigen, DI, EMPB3, EPB3MGC126623, erythrocyte membrane protein band 3, erythroid anion exchange protein, FR, Froese blood group, MGC116750, MGC116753, RTA1A, Solute carrier family 4 member 1, solute carrier family 4, anion exchanger, member 1 (erythrocyte membraneprotein band 3, Diego blood group), solute carrier family 4, anion exchanger, number 1, SW, Swann blood group, Waldner blood group, WD, WD1, WR, Wright blood group
Host Species
Rabbit
Molecular Weight of Antigen
102 kDa
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Equine 85%.
Target Species
Human, Equine, Rabbit
Isotype
IgG
Related Products
Description
- Band 3 Polyclonal specifically detects Band 3 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: Band 3
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: SLC4A1
Immunogen: Synthetic peptides corresponding to SLC4A1 (solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)) The peptide sequence was selected from the N terminal of SLC4A1. Peptide sequence PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR The peptide sequence for this immunogen was taken from within the described region.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 6521
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: AE 1, AE1MGC126619, Anion exchange protein 1, Anion exchanger 1, band 3 anion transport protein, BND3, CD233, CD233 antigen, DI, EMPB3, EPB3MGC126623, erythrocyte membrane protein band 3, erythroid anion exchange protein, FR, Froese blood group, MGC116750, MGC116753, RTA1A, Solute carrier family 4 member 1, solute carrier family 4, anion exchanger, member 1 (erythrocyte membraneprotein band 3, Diego blood group), solute carrier family 4, anion exchanger, number 1, SW, Swann blood group, Waldner blood group, WD, WD1, WR, Wright blood group
Host Species: Rabbit
Molecular Weight of Antigen: 102 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Equine 85%.
Target Species: Human, Equine, Rabbit
Isotype: IgG
Antigen: ARMH4
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: C14ORF37
Immunogen: Synthetic peptides corresponding to C14ORF37 The peptide sequence was selected from the N terminal of C14ORF37. Peptide sequence EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 145407
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: c14_5376, chromosome 14 open reading frame 37
Host Species: Rabbit
Molecular Weight of Antigen: 84 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Equine 77%.
Target Species: Human, Rat, Porcine, Bovine, Canine, Equine
Isotype: IgG
Antigen: C14orf80
Classification: Polyclonal
Conjugate: Unconjugated
Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Symbols: TEDC1
Immunogen: Synthetic peptides corresponding to C14ORF80 The peptide sequence was selected from the n terminal of C14ORF80. Peptide sequence MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ.
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 283643
Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Applications: Western Blot
Concentration: 0.5 mg/ml
Dilution: Western Blot 1.0 ug/ml
Gene Alias: chromosome 14 open reading frame 80
Host Species: Rabbit
Molecular Weight of Antigen: 28 kDa
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Rat 79%, Porcine 79%.
Target Species: Human, Rat, Bovine, Equine, Guinea Pig
Isotype: IgG
