SLC35B2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP180641-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP180641 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
SLC35B2
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias
adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, PAPST13'-phosphoadenosine 5'-phosphosulfate transporter, Putative MAPK-activating protein PM15, Putative NF-kappa-B-activating protein 48, SLL, Solute carrier family 35 member B2, solute carrier family 35 member B2 variant 2, solute carrier family 35, member B2, UGTrel4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
347734
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
SLC35B2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SLC35B2 Polyclonal specifically detects SLC35B2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC35B2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, PAPST13'-phosphoadenosine 5'-phosphosulfate transporter, Putative MAPK-activating protein PM15, Putative NF-kappa-B-activating protein 48, SLL, Solute carrier family 35 member B2, solute carrier family 35 member B2 variant 2, solute carrier family 35, member B2, UGTrel4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 347734
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SLC35B2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 347734
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: UGT
Classification: Polyclonal
Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
Gene Alias: solute carrier family 35 (UDP-galactose transporter), member 2, solute carrier family 35 (UDP-galactose transporter), member A2, UDP-galactose translocator, UGALTUGAT, UGT1, UGT2UDP-galactose transporter, UGTLSolute carrier family 35 member A2, UGTUDP-Gal-Tr
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 7355
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SLC35A2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.