SLCO4A1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP180977-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP180977 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SLCO4A1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
colon organic anion transporter, OATP1, OATP4A1, OATPE, OATP-E, OATP-RP1, organic anion-transporting polypeptide E, POAT, SLC21A12, solute carrier family 21 (organic anion transporter), member 12, solute carrier family 21 member 12, solute carrier organic anion transporter family member 4A1, solute carrier organic anion transporter family, member 4A1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
28231
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
SLCO4A1
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GRYEVELDAGVRTCPANPGAVCADSTSGLSRYQL
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SLCO4A1 Polyclonal specifically detects SLCO4A1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLCO4A1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: colon organic anion transporter, OATP1, OATP4A1, OATPE, OATP-E, OATP-RP1, organic anion-transporting polypeptide E, POAT, SLC21A12, solute carrier family 21 (organic anion transporter), member 12, solute carrier family 21 member 12, solute carrier organic anion transporter family member 4A1, solute carrier organic anion transporter family, member 4A1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 28231
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SLCO4A1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GRYEVELDAGVRTCPANPGAVCADSTSGLSRYQL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 28231
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: GRYEVELDAGVRTCPANPGAVCADSTSGLSRYQL
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: SLCO4A1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: colon organic anion transporter, OATP1, OATP4A1, OATPE, OATP-E, OATP-RP1, organic anion-transporting polypeptide E, POAT, SLC21A12, solute carrier family 21 (organic anion transporter), member 12, solute carrier family 21 member 12, solute carrier organic anion transporter family member 4A1, solute carrier organic anion transporter family, member 4A1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 28231
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: SLCO4A1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GYPRQLPGSQRYAVMRAAEMHQLKDSSRGEASNPDFGKTIRDLPL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.