ANKRD44 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP180887-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP180887 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ANKRD44
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
Q8N8A2
Gene Symbols
ANKRD44
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
ankyrin repeat domain 44, FLJ11570, MGC21968, MGC70444, PP6-ARS-BAnkyrin repeat domain-containing protein 44, protein phosphatase 6 ankyrin repeat subunit B, serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B, Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
91526
Target Species
Human
Isotype
IgG
Related Products
Description
- ANKRD44 Polyclonal specifically detects ANKRD44 in Human samples
- It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ANKRD44
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q8N8A2
Gene Symbols: ANKRD44
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ankyrin repeat domain 44, FLJ11570, MGC21968, MGC70444, PP6-ARS-BAnkyrin repeat domain-containing protein 44, protein phosphatase 6 ankyrin repeat subunit B, serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B, Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 91526
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 91526
Target Species: __
Isotype: __
Antigen: AVPI1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500
Gene Accession No.: __
Gene Symbols: AVPI1
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: arginine vasopressin-induced 1, arginine vasopressin-induced protein 1, AVP-induced protein 1, PP5395, RP11-548K23.7, vasopressin-induced transcript, VIP32, VIT32
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 60370
Target Species: Human
Isotype: IgG