STK19 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP184308-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP184308 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
STK19
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
D6S60, D6S60E, EC 2.7.11.1, G11nuclear serine/threonine protein kinase, HLA-RP1, MGC117388, MHC class III HLA-RP1, Protein G11, Protein RP1, RP1serine/threonine-protein kinase 19, serine/threonine kinase 19
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
STK19
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Quantity
0.1 mL
Research Discipline
Protein Kinase
Gene ID (Entrez)
8859
Target Species
Human
Isotype
IgG
Related Products
Description
- STK19 Polyclonal specifically detects STK19 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: STK19
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: D6S60, D6S60E, EC 2.7.11.1, G11nuclear serine/threonine protein kinase, HLA-RP1, MGC117388, MHC class III HLA-RP1, Protein G11, Protein RP1, RP1serine/threonine-protein kinase 19, serine/threonine kinase 19
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: STK19
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAG
Quantity: 0.1 mL
Research Discipline: Protein Kinase
Gene ID (Entrez): 8859
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 7923
Target Species: __
Isotype: __
Antigen: BRD2
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Gene Alias: bromodomain containing 2, bromodomain-containing 2, bromodomain-containing protein 2, D6S113E, female sterile homeotic-related gene 1, FSRG1FSH, KIAA9001FLJ31942, NAT, O27.1.1, Really interesting new gene 3 protein, RING3DKFZp686N0336, RNF3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human BRD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: BRD2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 6046
Target Species: Human
Isotype: IgG