BRUNOL5 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP189931-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP189931 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
BRUNOL5
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
60680
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
CELF5
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYAN
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- BRUNOL5 Polyclonal specifically detects BRUNOL5 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: BRUNOL5
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: Bruno (Drosophila) -like 5, RNA binding protein, BRUNOL-5, BRUNOL5bruno-like 5, RNA binding protein (Drosophila), bruno-like 5 RNA binding protein, Bruno-like protein 5, CELF-5, CUG-BP and ETR-3 like factor 5, CUG-BP- and ETR-3-like factor 5, CUGBP Elav-like family member 5, CUGBP, Elav-like family member 5, RNA-binding protein BRUNOL-5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 60680
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CELF5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYAN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: BRUNOL4
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: Bruno (Drosophila) -like 4, RNA binding protein, BRUNOL-4, BRUNOL4Bruno -like 4, RNA binding protein, bruno-like 4, RNA binding protein, bruno-like 4, RNA binding protein (Drosophila), Bruno-like protein 4, CELF-4, CUG-BP and ETR-3 like factor 4, CUG-BP- and ETR-3-like factor 4, CUGBP Elav-like family member 4, CUGBP, Elav-like family member 4, LYST-interacting protein LIP9, RNA-binding protein BRUNOL4, RNA-binding protein BRUNOL-4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 56853
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: CELF4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 56853
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.