NMDARA1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP192187-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP192187 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
NMDARA1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias
glutamate [NMDA] receptor-associated protein 1, glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding), glutamate receptor, NMDA subtype, glutamate-binding subunit, HNRGW, LFG1, NMDA receptor glutamate-binding subunit, NMDARA1MGC99687, Putative MAPK-activating protein PM02, TMBIM3, transmembrane BAX inhibitor motif containing 3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
2907
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
GRINA
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- NMDARA1 Polyclonal specifically detects NMDARA1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: NMDARA1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: glutamate [NMDA] receptor-associated protein 1, glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding), glutamate receptor, NMDA subtype, glutamate-binding subunit, HNRGW, LFG1, NMDA receptor glutamate-binding subunit, NMDARA1MGC99687, Putative MAPK-activating protein PM02, TMBIM3, transmembrane BAX inhibitor motif containing 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 2907
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: GRINA
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 2907
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: NME5
Classification: Polyclonal
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: Inhibitor of p53-induced apoptosis-beta, IPIA-beta, NDK-H 5, NDP kinase homolog 5, nm23-H5, NM23H5, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), nucleoside diphosphate kinase homolog 5, radial spoke 23 homolog, RSPH23, Testis-specific nm23 homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 8382
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: NME5
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.