KRAS Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233579-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233579 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
KRAS
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
P01116
Gene Symbols
KRAS
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
Quantity
0.1 mL
Research Discipline
Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Stem Cell Markers
Gene ID (Entrez)
3845
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
cellular c-Ki-ras2 proto-oncogene, c-Ki-ras, C-K-RAS, GTPase KRas, Ki-Ras, Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog, K-Ras 2, K-ras p21 protein, KRAS1, K-RAS2A, K-RAS2B, KRAS2NS3, K-RAS4A, K-RAS4B, NS, oncogene KRAS2, PR310 c-K-ras oncogene, RASK2c-Kirsten-ras protein, transforming protein p21, v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description KRAS Polyclonal specifically detects KRAS in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: KRAS
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P01116
Gene Symbols: KRAS
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
Quantity: 0.1 mL
Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Stem Cell Markers
Gene ID (Entrez): 3845
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: cellular c-Ki-ras2 proto-oncogene, c-Ki-ras, C-K-RAS, GTPase KRas, Ki-Ras, Kirsten rat sarcoma-2 viral (v-Ki-ras2) oncogene homolog, K-Ras 2, K-ras p21 protein, KRAS1, K-RAS2A, K-RAS2B, KRAS2NS3, K-RAS4A, K-RAS4B, NS, oncogene KRAS2, PR310 c-K-ras oncogene, RASK2c-Kirsten-ras protein, transforming protein p21, v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog, v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: MTMR2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q13614
Gene Symbols: MTMR2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKLAEMEEPPL
Quantity: 0.1 mL
Research Discipline: Cancer, Protein Phosphatase
Gene ID (Entrez): 8898
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CMT4B, CMT4B1, EC 3.1.3, EC 3.1.3.2, EC 3.1.3.48, KIAA1073EC 3.1.3.-, myotubularin related protein 2, myotubularin-related protein 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: CESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKLAEMEEPPL
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 8898
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.