Fc gamma RIIIA/CD16a Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233753-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233753 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
Fc gamma RIIIA/CD16a
Classification
Polyclonal
Dilution
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
P08637
Gene Symbols
FCGR3A
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FSVKTNIRSSTRDWKDHKFKWRKDPQDK
Quantity
0.1 mL
Research Discipline
Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells
Gene ID (Entrez)
2214
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Fc gamma RIIIA/CD16a Polyclonal specifically detects Fc gamma RIIIA/CD16a in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Fc gamma RIIIA/CD16a
Classification: Polyclonal
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P08637
Gene Symbols: FCGR3A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FSVKTNIRSSTRDWKDHKFKWRKDPQDK
Quantity: 0.1 mL
Research Discipline: Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells
Gene ID (Entrez): 2214
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: MIA2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q96PC5
Gene Symbols: MIA2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
Quantity: 0.1 mL
Research Discipline: __
Gene ID (Entrez): 117153
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ22404, melanoma inhibitory activity 2, melanoma inhibitory activity protein 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: TNDSLSLKPSWFDFGFAILGFAYAKEDKIMLDDRKNEEDGGADEHEHPLTSELDPEKEQEIETIKIIETEDQIDKKPVSEKTDESDTIP
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 117153
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
