CACNA1S Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233799-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP233799 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
CACNA1S
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q13698
Gene Symbols
CACNA1S
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL
Quantity
0.1 mL
Research Discipline
Neuroscience, Signal Transduction
Gene ID (Entrez)
779
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CACH1, CACN1, CACNL1A3MHS5, calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle, calcium channel, voltage-dependent, L type, alpha 1S subunit, Cav1.1, CCHL1A3, dihydropyridine receptor, dihydropyridine-sensitive L-type calcium channel alpha-1 subunit, HOKPP, HOKPP1, hypokalemic periodic paralysis), hypoPP, TTPP1, voltage-dependent L-type calcium channel subunit alpha-1S, Voltage-gated calcium channel subunit alpha Cav1.1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CACNA1S Polyclonal specifically detects CACNA1S in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: CACNA1S
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q13698
Gene Symbols: CACNA1S
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL
Quantity: 0.1 mL
Research Discipline: Neuroscience, Signal Transduction
Gene ID (Entrez): 779
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CACH1, CACN1, CACNL1A3MHS5, calcium channel, L type, alpha 1 polypeptide, isoform 3 (skeletal muscle, Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle, calcium channel, voltage-dependent, L type, alpha 1S subunit, Cav1.1, CCHL1A3, dihydropyridine receptor, dihydropyridine-sensitive L-type calcium channel alpha-1 subunit, HOKPP, HOKPP1, hypokalemic periodic paralysis), hypoPP, TTPP1, voltage-dependent L-type calcium channel subunit alpha-1S, Voltage-gated calcium channel subunit alpha Cav1.1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 779
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: DNA Polymerase gamma
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: P54098
Gene Symbols: POLG
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMD
Quantity: 0.1 mL
Research Discipline: DNA Polymerases, DNA Repair
Gene ID (Entrez): 5428
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: DNA polymerase subunit gamma-1, EC 2.7.7.7, FLJ27114, MDP1, MIRAS, Mitochondrial DNA polymerase catalytic subunit, MTDPS4A, PolG, catalytic subunit, POLG1MTDPS4B, PolG-alpha, POLGAPEO, polymerase (DNA directed), gamma, SANDO, SCAE
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.