SCN3A Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234003-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP234003 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SCN3A
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.
Q9NY46
Gene Symbols
SCN3A
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFSMDGNRLTS
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
brain III voltage-gated sodium channel, KIAA1356, NAC3, Nav1.3, Sodium channel protein brain III subunit alpha, sodium channel protein type 3 subunit alpha, Sodium channel protein type III subunit alpha, sodium channel, voltage-gated, type III, alpha polypeptide, sodium channel, voltage-gated, type III, alpha subunit, Voltage-gated sodium channel subtype III, Voltage-gated sodium channel subunit alpha Nav1.3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
6328
Target Species
Human
Isotype
IgG
Related Products
Description
- Description SCN3A Polyclonal specifically detects SCN3A in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SCN3A
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q9NY46
Gene Symbols: SCN3A
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFSMDGNRLTS
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: brain III voltage-gated sodium channel, KIAA1356, NAC3, Nav1.3, Sodium channel protein brain III subunit alpha, sodium channel protein type 3 subunit alpha, Sodium channel protein type III subunit alpha, sodium channel, voltage-gated, type III, alpha polypeptide, sodium channel, voltage-gated, type III, alpha subunit, Voltage-gated sodium channel subtype III, Voltage-gated sodium channel subunit alpha Nav1.3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6328
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: NRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFSMDGNRLTS
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 6328
Target Species: __
Isotype: __
Antigen: MEKK3
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q99759
Gene Symbols: MAP3K3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTTSSCAGASEKKKFLSDVRIKFEHNGE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.11.25, MAP/ERK kinase kinase 3, MAPK/ERK kinase kinase 3, MAPKKK3MEKK 3, MEK kinase 3, MEKK3, mitogen-activated protein kinase kinase kinase 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4215
Target Species: Human
Isotype: IgG