HSP10/EPF Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234055-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP234055 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
HSP10/EPF
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
P61604
Gene Symbols
HSPE1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Quantity
0.1 mL
Research Discipline
Core ESC Like Genes, Membrane Trafficking and Chaperones, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Gene ID (Entrez)
3336
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
10 kDa chaperonin, 10 kDa heat shock protein, mitochondrial, Chaperonin 10, CPN10HSP10, Early-pregnancy factor, EPF, GROES, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1 (chaperonin 10), Hsp10
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- HSP10/EPF Polyclonal specifically detects HSP10/EPF in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: HSP10/EPF
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: P61604
Gene Symbols: HSPE1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Quantity: 0.1 mL
Research Discipline: Core ESC Like Genes, Membrane Trafficking and Chaperones, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Gene ID (Entrez): 3336
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 10 kDa chaperonin, 10 kDa heat shock protein, mitochondrial, Chaperonin 10, CPN10HSP10, Early-pregnancy factor, EPF, GROES, heat shock 10kD protein 1 (chaperonin 10), heat shock 10kDa protein 1 (chaperonin 10), Hsp10
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: GQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSV
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 3336
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Alkaline Phosphatase/ALPP
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: P05187
Gene Symbols: ALPP
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NWYSDADVPASARQEGCQDIATQLISNMDI
Quantity: 0.1 mL
Research Discipline: Cancer, Embryonic Stem Cell Markers, Ovarian Carcinoma Cell Markers, Stem Cell Markers
Gene ID (Entrez): 250
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Alkaline phosphatase Regan isozyme, alkaline phosphatase, placental, alkaline phosphatase, placental (Regan isozyme), alkaline phosphatase, placental type, alkaline phosphomonoesterase, ALP, EC 3.1.3.1, FLJ61142, glycerophosphatase, PALP, Placental alkaline phosphatase 1, PLAP, PLAP-1, Regan isozyme
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.