NBP234604R
DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1), DyLight 550, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP234604R-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP234604R - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
DOG1/TMEM16A
Classification
Monoclonal
Conjugate
DyLight 550
Gene Alias
ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species
Mouse
Molecular Weight of Antigen
114 kDa
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Content And Storage
Store at 4C in the dark.
Isotype
IgG1 κ
Applications
Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone
DG1/447 + DOG-1.1
Dilution
Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols
ANO1
Immunogen
Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Purification Method
Protein A or G purified
Regulatory Status
RUO
Gene ID (Entrez)
55107
Target Species
Human
Form
Purified
Related Products
Description
- DOG1/TMEM16A Monoclonal specifically detects DOG1/TMEM16A in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: DOG1/TMEM16A
Classification: Monoclonal
Conjugate: DyLight 550
Gene Alias: ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species: Mouse
Molecular Weight of Antigen: 114 kDa
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Content And Storage: Store at 4C in the dark.
Isotype: IgG1 κ
Applications: Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: DG1/447 + DOG-1.1
Dilution: Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols: ANO1
Immunogen: Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Purification Method: Protein A or G purified
Regulatory Status: RUO
Gene ID (Entrez): 55107
Target Species: Human
Form: Purified
Antigen:
DOG1/TMEM16A
Classification:
Monoclonal
Conjugate:
DyLight 550
Gene Alias:
ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Host Species:
Mouse
Molecular Weight of Antigen:
114 kDa
Quantity:
0.1 mL
Primary or Secondary:
Primary
Test Specificity:
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Content And Storage:
Store at 4C in the dark.
Isotype:
IgG1 κ
Applications:
Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone:
DG1/447 + DOG-1.1
Dilution:
Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols:
ANO1
Immunogen:
Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Purification Method:
Protein A or G purified
Regulatory Status:
RUO
Gene ID (Entrez):
55107
Target Species:
Human
Form:
Purified
Antigen: p53
Classification: Monoclonal
Conjugate: Biotin
Gene Alias: Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species: Mouse
Molecular Weight of Antigen: 53 kDa
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53. Its epitope maps within the N-terminus (aa 37-45) of p53. Monoclonal antibody PAb1801 does not block the binding of DO-7 monoclonal antibody to p53 in an ELISA test. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b κ
Applications: Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone: DO-7
Dilution: Western Blot, Simple Western, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols: TP53
Immunogen: Recombinant human wild type p53 protein expressed in E. coli. (Uniprot: P04637)
Purification Method: Protein A or G purified
Regulatory Status: RUO
Gene ID (Entrez): 7157
Target Species: Human, Bovine, Primate
Form: Purified
Antigen:
p53
Classification:
Monoclonal
Conjugate:
Biotin
Gene Alias:
Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species:
Mouse
Molecular Weight of Antigen:
53 kDa
Quantity:
0.1 mL
Primary or Secondary:
Primary
Test Specificity:
Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53. Its epitope maps within the N-terminus (aa 37-45) of p53. Monoclonal antibody PAb1801 does not block the binding of DO-7 monoclonal antibody to p53 in an ELISA test. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage:
Store at 4C in the dark.
Isotype:
IgG2b κ
Applications:
Western Blot, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Clone:
DO-7
Dilution:
Western Blot, Simple Western, Flow Cytometry, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols:
TP53
Immunogen:
Recombinant human wild type p53 protein expressed in E. coli. (Uniprot: P04637)
Purification Method:
Protein A or G purified
Regulatory Status:
RUO
Gene ID (Entrez):
7157
Target Species:
Human, Bovine, Primate
Form:
Purified
Antigen: p53
Classification: Monoclonal
Conjugate: DyLight 550
Gene Alias: Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species: Mouse
Molecular Weight of Antigen: 53 kDa
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53. Its epitope maps within the N-terminus (aa 37-45) of p53. Monoclonal antibody PAb1801 does not block the binding of DO-7 monoclonal antibody to p53 in an ELISA test. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b κ
Applications: Western Blot, Flow Cytometry, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone: DO-7
Dilution: Western Blot, Flow Cytometry, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols: TP53
Immunogen: Recombinant human wild type p53 protein expressed in E. coli. (Uniprot: P04637)
Purification Method: Protein A or G purified
Regulatory Status: RUO
Gene ID (Entrez): 7157
Target Species: Human, Bovine, Primate
Form: Purified
Antigen:
p53
Classification:
Monoclonal
Conjugate:
DyLight 550
Gene Alias:
Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species:
Mouse
Molecular Weight of Antigen:
53 kDa
Quantity:
0.1 mL
Primary or Secondary:
Primary
Test Specificity:
Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53. Its epitope maps within the N-terminus (aa 37-45) of p53. Monoclonal antibody PAb1801 does not block the binding of DO-7 monoclonal antibody to p53 in an ELISA test. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage:
Store at 4C in the dark.
Isotype:
IgG2b κ
Applications:
Western Blot, Flow Cytometry, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone:
DO-7
Dilution:
Western Blot, Flow Cytometry, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols:
TP53
Immunogen:
Recombinant human wild type p53 protein expressed in E. coli. (Uniprot: P04637)
Purification Method:
Protein A or G purified
Regulatory Status:
RUO
Gene ID (Entrez):
7157
Target Species:
Human, Bovine, Primate
Form:
Purified
Antigen: p53
Classification: Monoclonal
Conjugate: Alexa Fluor 488
Gene Alias: Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species: Mouse
Molecular Weight of Antigen: 53 kDa
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53. Its epitope maps within the N-terminus (aa 37-45) of p53. Monoclonal antibody PAb1801 does not block the binding of DO-7 monoclonal antibody to p53 in an ELISA test. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage: Store at 4C in the dark.
Isotype: IgG2b κ
Applications: Western Blot, Flow Cytometry, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone: DO-7
Dilution: Western Blot, Flow Cytometry, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols: TP53
Immunogen: Recombinant human wild type p53 protein expressed in E. coli. (Uniprot: P04637)
Purification Method: Protein A or G purified
Regulatory Status: RUO
Gene ID (Entrez): 7157
Target Species: Human, Bovine, Primate
Form: Purified
Antigen:
p53
Classification:
Monoclonal
Conjugate:
Alexa Fluor 488
Gene Alias:
Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
Host Species:
Mouse
Molecular Weight of Antigen:
53 kDa
Quantity:
0.1 mL
Primary or Secondary:
Primary
Test Specificity:
Recognizes a 53kDa protein, which is identified as p53 suppressor gene product. It reacts with the mutant as well as the wild form of p53. Its epitope maps within the N-terminus (aa 37-45) of p53. Monoclonal antibody PAb1801 does not block the binding of DO-7 monoclonal antibody to p53 in an ELISA test. p53 is a tumor suppressor gene expressed in a wide variety of tissue types and is involved in regulating cell growth, replication, and apoptosis. It binds to MDM2, SV40 T antigen and human papilloma virus E6 protein. Positive nuclear staining with p53 antibody has been reported to be a negative prognostic factor in breast carcinoma, lung carcinoma, colorectal, and urothelial carcinoma. Anti-p53 positivity has also been used to differentiate uterine serous carcinoma from endometrioid carcinoma as well as to detect intratubular germ cell neoplasia. Mutations involving p53 are found in a wide variety of malignant tumors, including breast, ovarian, bladder, colon, lung, and melanoma.
Content And Storage:
Store at 4C in the dark.
Isotype:
IgG2b κ
Applications:
Western Blot, Flow Cytometry, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone:
DO-7
Dilution:
Western Blot, Flow Cytometry, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Gene Symbols:
TP53
Immunogen:
Recombinant human wild type p53 protein expressed in E. coli. (Uniprot: P04637)
Purification Method:
Protein A or G purified
Regulatory Status:
RUO
Gene ID (Entrez):
7157
Target Species:
Human, Bovine, Primate
Form:
Purified