Connexin 43/GJA1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238234-Each-of-1 | In Stock | ₹ 55,485.66 |
NBP238234 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,485.66
GST (18%): ₹ 9,987.419
Total Price: ₹ 65,473.079
Antigen
Connexin 43/GJA1
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
P17302
Gene Symbols
GJA1
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
Quantity
0.1 mL
Research Discipline
Cancer, Cellular Markers, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers
Gene ID (Entrez)
2697
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
connexin 43, connexin-43, Cx43, CX43gap junction protein, alpha-like, DFNB38, Gap junction 43 kDa heart protein, gap junction alpha-1 protein, gap junction protein, alpha 1, 43kDa, gap junction protein, alpha 1, 43kDa (connexin 43), GJAL, HSS, ODD, ODDD, ODOD, SDTY3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Connexin 43/GJA1 Polyclonal specifically detects Connexin 43/GJA1 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Connexin 43/GJA1
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: P17302
Gene Symbols: GJA1
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
Quantity: 0.1 mL
Research Discipline: Cancer, Cellular Markers, Core ESC Like Genes, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers
Gene ID (Entrez): 2697
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: connexin 43, connexin-43, Cx43, CX43gap junction protein, alpha-like, DFNB38, Gap junction 43 kDa heart protein, gap junction alpha-1 protein, gap junction protein, alpha 1, 43kDa, gap junction protein, alpha 1, 43kDa (connexin 43), GJAL, HSS, ODD, ODDD, ODOD, SDTY3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 2697
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: GRAF
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: Q9UNA1
Gene Symbols: ARHGAP26
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
Quantity: 0.1 mL
Research Discipline: Neuroscience, Stem Cell Markers
Gene ID (Entrez): 23092
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: FLJ42530, GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK), KIAA0621rho GTPase-activating protein 26, Oligophrenin-1-like protein, OPHN1L1, OPHN1LGTPase regulator associated with focal adhesion kinase, Rho GTPase activating protein 26, Rho-type GTPase-activating protein 26
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.