SERPINB13 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238821-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238821 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SERPINB13
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.
Q9UIV8
Gene Symbols
SERPINB13
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13, serpin B13, serpin peptidase inhibitor, clade B (ovalbumin), member 13, UV-B repressed sequence, HUR 7
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5275
Target Species
Human
Isotype
IgG
Related Products
Description
- Description SERPINB13 Polyclonal specifically detects SERPINB13 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SERPINB13
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No.: Q9UIV8
Gene Symbols: SERPINB13
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13, serpin B13, serpin peptidase inhibitor, clade B (ovalbumin), member 13, UV-B repressed sequence, HUR 7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5275
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 5275
Target Species: __
Isotype: __
Antigen: UBE2S
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Accession No.: Q16763
Gene Symbols: UBE2S
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPN
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: E2-EPF5, E2-EPFEC 6.3.2.19, E2EPFEPF5, Ubiquitin carrier protein S, ubiquitin-conjugating enzyme E2 S, ubiquitin-conjugating enzyme E2-24 kD, Ubiquitin-conjugating enzyme E2-24 kDa, Ubiquitin-conjugating enzyme E2-EPF5, ubiquitin-conjugating enzyme E2S, Ubiquitin-protein ligase S
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 27338
Target Species: Human
Isotype: IgG