SMARCA6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP238986-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP238986 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SMARCA6
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.
Q9NRZ9
Gene Symbols
HELLS
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV
Quantity
0.1 mL
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez)
3070
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SMARCA6 Polyclonal specifically detects SMARCA6 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SMARCA6
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Accession No.: Q9NRZ9
Gene Symbols: HELLS
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV
Quantity: 0.1 mL
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Gene ID (Entrez): 3070
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 3070
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: MARCH6
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Accession No.: O60337
Gene Symbols: MARCHF6
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE
Quantity: 0.1 mL
Research Discipline: Zinc Finger
Gene ID (Entrez): 10299
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: E3 ubiquitin-protein ligase MARCH6, EC 6.3.2.-, MARCH-VIDOA10, membrane-associated ring finger (C3HC4) 6, Membrane-associated RING finger protein 6, Membrane-associated RING-CH protein VI, Protein TEB-4, RNF176KIAA0597Doa10 homolog, TEB4RING finger protein 176
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.