ABCG1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254682-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP254682 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ABCG1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1
Host Species
Rabbit
Purification Method
Immunogen affinity purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ABCG1
Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids:EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
Quantity
100 μL
Research Discipline
ABC Transporters, Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction
Gene ID (Entrez)
9619
Target Species
Human
Isotype
IgG
Related Products
Description
- ABCG1 Polyclonal specifically detects ABCG1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ABCG1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1
Host Species: Rabbit
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ABCG1
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
Quantity: 100 μL
Research Discipline: ABC Transporters, Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction
Gene ID (Entrez): 9619
Target Species: Human
Isotype: IgG
Antigen: Chorionic Gonadotropin beta Chain (HCG beta)
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: CGB3choriogonadotropin subunit beta, CGB5, CGB7, CGB8, CG-beta, Chorionic gonadotrophin chain beta, chorionic gonadotropin beta 3 subunit, chorionic gonadotropin beta chain, chorionic gonadotropin beta subunit, chorionic gonadotropin, beta polypeptide, hCGB
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CGB3
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 1082
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CGB, CGB3, CGB3choriogonadotropin subunit beta, CGB5, CGB7, CGB8, CG-Beta
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): __
Target Species: __
Isotype: __