alpha Tubulin Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254708-Each-of-1 | In Stock | ₹ 58,865.28 |
NBP254708 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 58,865.28
GST (18%): ₹ 10,595.75
Total Price: ₹ 69,461.03
Antigen
alpha Tubulin
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
Alpha-tubulin 3, B-ALPHA-1, FLJ25113, hum-a-tub1, hum-a-tub2, LIS3, TUBA3, tubulin alpha-1A chain, Tubulin alpha-3 chain, Tubulin B-alpha-1, tubulin, alpha 1a, tubulin, alpha 3, tubulin, alpha, brain-specific
Host Species
Rabbit
Molecular Weight of Antigen
50 kDa
Quantity
100 μL
Research Discipline
Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Loading Controls, Neuroscience
Gene ID (Entrez)
7846
Target Species
Human, Mouse, Rat
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TUBA1A
Immunogen
This alpha Tubulin Antibody was developed against a recombinant protein corresponding to amino acids: ATYAPVISAEKAYHEQLSVAEITN
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- alpha Tubulin Polyclonal specifically detects alpha Tubulin in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: alpha Tubulin
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: Alpha-tubulin 3, B-ALPHA-1, FLJ25113, hum-a-tub1, hum-a-tub2, LIS3, TUBA3, tubulin alpha-1A chain, Tubulin alpha-3 chain, Tubulin B-alpha-1, tubulin, alpha 1a, tubulin, alpha 3, tubulin, alpha, brain-specific
Host Species: Rabbit
Molecular Weight of Antigen: 50 kDa
Quantity: 100 μL
Research Discipline: Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Loading Controls, Neuroscience
Gene ID (Entrez): 7846
Target Species: Human, Mouse, Rat
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TUBA1A
Immunogen: This alpha Tubulin Antibody was developed against a recombinant protein corresponding to amino acids: ATYAPVISAEKAYHEQLSVAEITN
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: Alpha-tubulin 3, B-ALPHA-1, FLJ25113, hum-a-tub1, hum-a-tub2, LIS3, TUBA3, tubulin alpha-1A chain, Tubulin alpha-3 chain, Tubulin B-alpha-1, tubulin, alpha 1a, tubulin, alpha 3, tubulin, alpha, brain-specific
Host Species: __
Molecular Weight of Antigen: __
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): __
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Purification Method: __
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: ACOT1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1 - 4ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: ACH2, acyl-CoA thioesterase 1Long chain acyl-CoA thioester hydrolase, acyl-coenzyme A thioesterase 1, CTE1, CTE-1, CTE-I, CTE-Ib, EC 3.1.2.2, Inducible cytosolic acyl-coenzyme A thioester hydrolase, LACH2, Long chain acyl-CoA hydrolase
Host Species: Rabbit
Molecular Weight of Antigen: __
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 641371
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ACOT1
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
Purification Method: Immunogen affinity purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.