Thioredoxin Reductase 1/TRXR1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255363-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255363 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Thioredoxin Reductase 1/TRXR1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, thioredoxin reductase 1, thioredoxin reductase 1, cytoplasmic, thioredoxin reductase GRIM-12, Thioredoxin reductase TR1, TR, Trxr1, TXNRTRXR1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TXNRD1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML
Quantity
100 μL
Research Discipline
Breast Cancer, Lipid and Metabolism
Gene ID (Entrez)
7296
Target Species
Human
Isotype
IgG
Related Products
Description
- Thioredoxin Reductase 1/TRXR1 Polyclonal specifically detects Thioredoxin Reductase 1/TRXR1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Thioredoxin Reductase 1/TRXR1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, thioredoxin reductase 1, thioredoxin reductase 1, cytoplasmic, thioredoxin reductase GRIM-12, Thioredoxin reductase TR1, TR, Trxr1, TXNRTRXR1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TXNRD1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML
Quantity: 100 μL
Research Discipline: Breast Cancer, Lipid and Metabolism
Gene ID (Entrez): 7296
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, t
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 7296
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: AA-NAT, aralkylamine N-acetyltransferaseEC 2.3.1.87, arylalkylamine N-acetyltransferase, Serotonin acetylase, SNATserotonin N-acetyltransferase
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 15
Target Species: __
Isotype: __
