SPAG9 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256914-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256914 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SPAG9
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Cancer/testis antigen 89, c-Jun NH2-terminal kinase-associated leucine zipper protein, C-Jun-amino-terminal kinase-interacting protein 4, CT89JIP4, FLJ14006, FLJ26141, FLJ34602, HLC4, HLC-6, HSS, Human lung cancer oncogene 6 protein, JLPPHETSYD1FLJ13450, JNK interacting protein, JNK/SAPK-associated protein, JNK-associated leucine-zipper protein, JNK-interacting protein 4, KIAA0516JIP-4, lung cancer oncogene 4, MAPK8IP4, Max-binding protein, MGC117291, MGC14967, MGC74461, Mitogen-activated protein kinase 8-interacting protein 4, PIG6, proliferation-inducing gene 6, Proliferation-inducing protein 6, Protein highly expressed in testis, sperm associated antigen 9, Sperm surface protein, Sperm-associated antigen 9, Sperm-specific protein, Sunday driver 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SPAG9
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Signal Transduction
Gene ID (Entrez)
9043
Target Species
Human
Isotype
IgG
Related Products
Description
- SPAG9 Polyclonal specifically detects SPAG9 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SPAG9
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Cancer/testis antigen 89, c-Jun NH2-terminal kinase-associated leucine zipper protein, C-Jun-amino-terminal kinase-interacting protein 4, CT89JIP4, FLJ14006, FLJ26141, FLJ34602, HLC4, HLC-6, HSS, Human lung cancer oncogene 6 protein, JLPPHETSYD1FLJ13450, JNK interacting protein, JNK/SAPK-associated protein, JNK-associated leucine-zipper protein, JNK-interacting protein 4, KIAA0516JIP-4, lung cancer oncogene 4, MAPK8IP4, Max-binding protein, MGC117291, MGC14967, MGC74461, Mitogen-activated protein kinase 8-interacting protein 4, PIG6, proliferation-inducing gene 6, Proliferation-inducing protein 6, Protein highly expressed in testis, sperm associated antigen 9, Sperm surface protein, Sperm-associated antigen 9, Sperm-specific protein, Sunday driver 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SPAG9
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVL
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Signal Transduction
Gene ID (Entrez): 9043
Target Species: Human
Isotype: IgG
Antigen: Dlx6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: distal-less homeo box 6, distal-less homeobox 6, homeobox protein DLX-6, MGC125282, MGC125283, MGC125284, MGC125285
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DLX6
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRF
Quantity: 100 μL
Research Discipline: Neuroscience
Gene ID (Entrez): 1750
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: distal-less homeo box 6, distal-less homeobox 6, homeobox protein DLX-6, MGC125282, MGC125283, MGC125284, MGC125285
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1750
Target Species: __
Isotype: __
