Aggrecan Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255540-Each-of-1 | In Stock | ₹ 55,742.34 |
NBP255540 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,742.34
GST (18%): ₹ 10,033.621
Total Price: ₹ 65,775.961
Antigen
Aggrecan
Classification
Polyclonal
Dilution
Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16AGCAN
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ACAN
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSAFHEANLERSSGLGVSGSTLTFQEGEASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVISTSIP
Quantity
100 μL
Research Discipline
Extracellular Matrix, Growth and Development, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers
Gene ID (Entrez)
176
Target Species
Human
Isotype
IgG
Related Products
Description
- Aggrecan Polyclonal specifically detects Aggrecan in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Aggrecan
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16AGCAN
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ACAN
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSAFHEANLERSSGLGVSGSTLTFQEGEASAAPEVSGESTTTSDVGTEAPGLPSATPTASGDRTEISGDLSGHTSQLGVVISTSIP
Quantity: 100 μL
Research Discipline: Extracellular Matrix, Growth and Development, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers
Gene ID (Entrez): 176
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: DXS1272EMRXJ, EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1C, JARID1Clysine-specific demethylase 5C, jumonji, AT rich interactive domain 1C, Jumonji, AT rich interactive domain 1C (RBP2-like), Jumonji/ARID domain-containing protein 1C, lysine (K)-s
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8242
Target Species: __
Isotype: __
Antigen: Annexin A8/ANXA8
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: annexin A8, Annexin VIII, Annexin-8, ANX8, FLJ53095, VAC-beta, Vascular anticoagulant-beta
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ANXA8
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGTKEGVIIEILASRTKNQLREIMKAYEEDYG
Quantity: 100 μL
Research Discipline: Signal Transduction
Gene ID (Entrez): 653145
Target Species: Human
Isotype: IgG