NBP255542PE
Novus Biologicals™ Annexin A8/ANXA8 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255542PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255542PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
653145
Common Name
Annexin A8/ANXA8 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
annexin A8, Annexin VIII, Annexin-8, ANX8, FLJ53095, VAC-beta, Vascular anticoagulant-beta
Label Type
Unlabeled
Quantity
100μL
Research Category
Signal Transduction
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50948. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ANXA8
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.Coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Annexin A8/ANXA8
- Source: E.coli Amino Acid Sequence: LGTKEGVIIEILASRTKNQLREIMKAYEEDYG The Annexin A8/ANXA8 Recombinant Protein Antigen is derived from E
- coli
- The Annexin A8/ANXA8 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 653145
Common Name: Annexin A8/ANXA8 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: annexin A8, Annexin VIII, Annexin-8, ANX8, FLJ53095, VAC-beta, Vascular anticoagulant-beta
Label Type: Unlabeled
Quantity: 100μL
Research Category: Signal Transduction
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50948. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ANXA8
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
653145
Common Name:
Annexin A8/ANXA8 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
annexin A8, Annexin VIII, Annexin-8, ANX8, FLJ53095, VAC-beta, Vascular anticoagulant-beta
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Signal Transduction
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50948. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ANXA8
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 2189
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DNA repair protein XRCC9, FAG, Fanconi anemia group G protein, Fanconi anemia, complementation group G, Protein FACG, X-ray repair, complementing defective, in Chinese hamster, 9, XRCC9X-ray repair complementing defective repair in Chinese hamster cells 9
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
2189
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DNA repair protein XRCC9, FAG, Fanconi anemia group G protein, Fanconi anemia, complementation group G, Protein FACG, X-ray repair, complementing defective, in Chinese hamster, 9, XRCC9X-ray repair complementing defective repair in Chinese hamster cells 9
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 2189
Common Name: FANCG Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DNA repair protein XRCC9, FAG, Fanconi anemia group G protein, Fanconi anemia, complementation group G, Protein FACG, X-ray repair, complementing defective, in Chinese hamster, 9, XRCC9X-ray repair complementing defective repair in Chinese hamster cells 9
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51464. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FANCG
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
2189
Common Name:
FANCG Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DNA repair protein XRCC9, FAG, Fanconi anemia group G protein, Fanconi anemia, complementation group G, Protein FACG, X-ray repair, complementing defective, in Chinese hamster, 9, XRCC9X-ray repair complementing defective repair in Chinese hamster cells 9
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51464. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FANCG
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 121642
Common Name: ABH2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51466. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ALKBH2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
121642
Common Name:
ABH2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
2OG-Fe(II) oxy DC1, ABH2FLJ99103, alkB, alkylation repair homolog 2 (E. coli), Alkylated DNA repair protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase alkB homolog 2, EC 1.14.11.-, MGC90512, Oxy DC1
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51466. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ALKBH2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli