PFKFB4 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255750-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255750 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PFKFB4
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme, bifunctional enzyme with kinase and biphosphatase activities, PFK/FBPase 4
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5210
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PFKFB4
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- PFKFB4 Polyclonal specifically detects PFKFB4 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PFKFB4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme, bifunctional enzyme with kinase and biphosphatase activities, PFK/FBPase 4
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5210
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PFKFB4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme, bifunctional enzyme with kinase and biphosphatase activities, PFK/FBPase 4
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 5210
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: PPP1R11
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6992
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PPP1R11
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSTESDEEEEEGCGHTHCVRGHRKGRRRATL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.