NBP255750PE
Novus Biologicals™ PFKFB4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255750PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255750PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5210
Common Name
PFKFB4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme, bifunctional enzyme with kinase and biphosphatase activities, PFK/FBPase 4
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PFKFB4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51537. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFKFB4
- Source: E.coli Amino Acid Sequence: RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI The PFKFB4 Recombinant Protein Antigen is derived from E
- coli
- The PFKFB4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5210
Common Name: PFKFB4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme, bifunctional enzyme with kinase and biphosphatase activities, PFK/FBPase 4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PFKFB4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51537. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5210
Common Name:
PFKFB4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4,6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4,6PF-2-K/Fru-2,6-P2ase 4,6PF-2-K/Fru-2,6-P2ase testis-type isozyme, bifunctional enzyme with kinase and biphosphatase activities, PFK/FBPase 4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PFKFB4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51537. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6992
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6992
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6992
Common Name: PPP1R11 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PPP1R11
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52405. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6992
Common Name:
PPP1R11 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PPP1R11
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52405. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57096
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CORD13, DKFZp686P0897, LCA6RGRIP, retinitis pigmentosa GTPase regulator interacting protein 1, RGI1, RPGR-interacting protein 1, RPGRIP, RPGRIP1d, X-linked retinitis pigmentosa GTPase regulator-interacting protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57096
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CORD13, DKFZp686P0897, LCA6RGRIP, retinitis pigmentosa GTPase regulator interacting protein 1, RGI1, RPGR-interacting protein 1, RPGRIP, RPGRIP1d, X-linked retinitis pigmentosa GTPase regulator-interacting protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__