NBP255842PE
Novus Biologicals™ GMPR2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255842PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255842PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51292
Common Name
GMPR2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Label Type
Unlabeled
Quantity
100μL
Research Category
Proteases & Other Enzymes
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
GMPR2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.Coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GMPR2
- Source: E.coli Amino Acid Sequence: KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC The GMPR2 Recombinant Protein Antigen is derived from E
- coli
- The GMPR2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51292
Common Name: GMPR2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Label Type: Unlabeled
Quantity: 100μL
Research Category: Proteases & Other Enzymes
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GMPR2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
51292
Common Name:
GMPR2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Proteases & Other Enzymes
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GMPR2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 10927
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: OCR, spindlin, spindlin 1, spindlin-1, SPINOvarian cancer-related protein
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
10927
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
OCR, spindlin, spindlin 1, spindlin-1, SPINOvarian cancer-related protein
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 10927
Common Name: SPIN1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: OCR, spindlin, spindlin 1, spindlin-1, SPINOvarian cancer-related protein
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53112. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SPIN1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
10927
Common Name:
SPIN1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
OCR, spindlin, spindlin 1, spindlin-1, SPINOvarian cancer-related protein
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53112. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SPIN1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 57129
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CGI-204, L47mt, MGC45403, mitochondrial ribosomal protein L47, MRP-L47, nasopharyngeal carcinoma metastasis-related 1, Nasopharyngeal carcinoma metastasis-related protein 1, NCM139S ribosomal protein L47, mitochondrial
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
57129
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CGI-204, L47mt, MGC45403, mitochondrial ribosomal protein L47, MRP-L47, nasopharyngeal carcinoma metastasis-related 1, Nasopharyngeal carcinoma metastasis-related protein 1, NCM139S ribosomal protein L47, mitochondrial
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__