SETD8 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255772-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255772 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SETD8
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
H4-K20-HMTase SETD8, H4K20-specific histone methyltransferase splice variant Set8b, Histone-lysine N-methyltransferase SETD8, KMT5A, KMT5A SET domain-containing protein 8, Lysine N-methyltransferase 5A, PR/SET domain containing protein 8, PR/SET domain-containing protein 07, PR/SET07, PRSET7, PR-Set7EC 2.1.1.43, SET domain containing (lysine methyltransferase) 8, SET07SET8H4-K20-specific histone methyltransferase, SET8
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
KMT5A
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Epigenetics
Gene ID (Entrez)
387893
Target Species
Human
Isotype
IgG
Related Products
Description
- Description SETD8 Polyclonal specifically detects SETD8 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SETD8
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: H4-K20-HMTase SETD8, H4K20-specific histone methyltransferase splice variant Set8b, Histone-lysine N-methyltransferase SETD8, KMT5A, KMT5A SET domain-containing protein 8, Lysine N-methyltransferase 5A, PR/SET domain containing protein 8, PR/SET domain-containing protein 07, PR/SET07, PRSET7, PR-Set7EC 2.1.1.43, SET domain containing (lysine methyltransferase) 8, SET07SET8H4-K20-specific histone methyltransferase, SET8
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KMT5A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Epigenetics
Gene ID (Entrez): 387893
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: H4-K20-HMTase SETD8, H4K20-specific histone methyltransferase splice variant Set8b, Histone-lysine N-methyltransferase SETD8, KMT5A, KMT5A SET domain-containing protein 8, Lysine N-methyltransferase 5A, PR/SET domain containing protein 8, PR/SET domain-co
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 387893
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: 4 (parvulin), MGC138486, Parvulin-17, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5303
Target Species: __
Isotype: __
