GMPR2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255842-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255842 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
GMPR2
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GMPR2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
Quantity
100 μL
Research Discipline
Proteases & Other Enzymes
Gene ID (Entrez)
51292
Target Species
Human
Isotype
IgG
Related Products
Description
- GMPR2 Polyclonal specifically detects GMPR2 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: GMPR2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GMPR2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYIC
Quantity: 100 μL
Research Discipline: Proteases & Other Enzymes
Gene ID (Entrez): 51292
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 1.7.1.7, GMP reductase 2, Guanosine 5'-monophosphate oxidoreductase 2, guanosine monophosphate reductase 2MGC830, guanosine monophosphate reductase isolog, MGC15084
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 51292
Target Species: __
Isotype: __
Antigen: SPIN1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: OCR, spindlin, spindlin 1, spindlin-1, SPINOvarian cancer-related protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SPIN1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNI
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 10927
Target Species: Human
Isotype: IgG