U2AF1L4 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255898-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255898 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
U2AF1L4
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1-like protein 3, U2AF1RS3, U2AF1-RS3, U2af26
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
199746
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
U2AF1L4
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- U2AF1L4 Polyclonal specifically detects U2AF1L4 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: U2AF1L4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1-like protein 3, U2AF1RS3, U2AF1-RS3, U2af26
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 199746
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: U2AF1L4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA a
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 199746
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: CRACC/SLAMF7
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SLAM family member 7
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 57823
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SLAMF7
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.