Glucagon R/GCGR Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255921-Each-of-1 | In Stock | ₹ 52,277.16 |
NBP255921 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 52,277.16
GST (18%): ₹ 9,409.889
Total Price: ₹ 61,687.049
Antigen
Glucagon R/GCGR
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
FLJ97182, GGR, GL-R, glucagon receptor, MGC138246
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GCGR
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC
Quantity
100 μL
Research Discipline
GPCR, Signal Transduction
Gene ID (Entrez)
2642
Target Species
Human
Isotype
IgG
Description
- Description Glucagon R/GCGR Polyclonal specifically detects Glucagon R/GCGR in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Glucagon R/GCGR
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ97182, GGR, GL-R, glucagon receptor, MGC138246
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GCGR
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC
Quantity: 100 μL
Research Discipline: GPCR, Signal Transduction
Gene ID (Entrez): 2642
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: FLJ97182, GGR, GL-R, glucagon receptor, MGC138246
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 2642
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosoph
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5141
Target Species: __
Isotype: __