NBP255923PE
Novus Biologicals™ Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255923PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255923PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5141
Common Name
Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosoph
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PDE4A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53558. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Phosphodiesterase 4A/PDE4A
- Source: E.coli Amino Acid Sequence: LRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEEL The Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen is derived from E
- coli
- The Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5141
Common Name: Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosoph
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PDE4A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53558. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5141
Common Name:
Phosphodiesterase 4A/PDE4A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosoph
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PDE4A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53558. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 222223
Common Name: KIAA1324L Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: estrogen-induced gene 121-like protein, FLJ31340, KIAA1324-like
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: KIAA1324L
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53559. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
222223
Common Name:
KIAA1324L Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
estrogen-induced gene 121-like protein, FLJ31340, KIAA1324-like
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
KIAA1324L
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53559. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 653519
Common Name: GPCR GPR89 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ10492, FLJ11696, FLJ36909, FLJ79270, G protein-coupled receptor 89A, Golgi pH regulator A, GPHRA, GPR89, GPR89B, MGC688, MGC87324, protein GPR89, Protein GPR89A, Putative MAPK-activating protein PM01, Putative NF-kappa-B-activating protein 90, SH120, U
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GPR89A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51010. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
653519
Common Name:
GPCR GPR89 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ10492, FLJ11696, FLJ36909, FLJ79270, G protein-coupled receptor 89A, Golgi pH regulator A, GPHRA, GPR89, GPR89B, MGC688, MGC87324, protein GPR89, Protein GPR89A, Putative MAPK-activating protein PM01, Putative NF-kappa-B-activating protein 90, SH120, U
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GPR89A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51010. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 197358
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CARD15-Like Protein, Caterpiller Protein 16.2, CLR16.2, Leucine Rich Repeat And CARD Domain Containing 3, NLR Family, CARD Domain Containing 3, NOD3, NOD-Like Receptor C3, Nucleotide-Binding Oligomerization Domain Protein 3, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And CARD Domain Containing 3, Protein NLRC3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
197358
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CARD15-Like Protein, Caterpiller Protein 16.2, CLR16.2, Leucine Rich Repeat And CARD Domain Containing 3, NLR Family, CARD Domain Containing 3, NOD3, NOD-Like Receptor C3, Nucleotide-Binding Oligomerization Domain Protein 3, Nucleotide-Binding Oligomerization Domain, Leucine Rich Repeat And CARD Domain Containing 3, Protein NLRC3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__