TrkC Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255927-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255927 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
TrkC
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3 growth factor receptor, Trk-C, TrkC tyrosine kinase, TRKCneurotrophin 3 receptor, tyrosine kinase receptor C
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NTRK3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI
Quantity
100 μL
Research Discipline
Cancer, Protein Kinase
Gene ID (Entrez)
4916
Target Species
Human
Isotype
IgG
Related Products
Description
- TrkC Polyclonal specifically detects TrkC in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TrkC
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3 growth factor receptor, Trk-C, TrkC tyrosine kinase, TRKCneurotrophin 3 receptor, tyrosine kinase receptor C
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NTRK3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI
Quantity: 100 μL
Research Discipline: Cancer, Protein Kinase
Gene ID (Entrez): 4916
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 2.7.10, EC 2.7.10.1, ETS related protein-neurotrophic receptor tyrosine kinase fusion protein, ETV6-NTRK3 fusion, gp145(trkC), GP145-TrkC, Neurotrophic tyrosine kinase receptor type 3, neurotrophic tyrosine kinase, receptor, type 3, NT 3 receptor, NT-3
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 4916
Target Species: __
Isotype: __
Antigen: Exportin-T
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: exportin(tRNA), exportin, tRNA (nuclear export receptor for tRNAs), exportin-T, tRNA exportin, XPO3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: XPOT
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAY
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 11260
Target Species: Human
Isotype: IgG