DDR2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256485-Each-of-1 | In Stock | ₹ 57,367.98 |
NBP256485 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 57,367.98
GST (18%): ₹ 10,326.236
Total Price: ₹ 67,694.216
Antigen
DDR2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CD167 antigen-like family member B, CD167b antigen, Discoidin domain receptor 2, discoidin domain receptor family, member 2, discoidin domain receptor tyrosine kinase 2, discoidin domain-containing receptor 2, EC 2.7.10, EC 2.7.10.1, hydroxyaryl-protein kinase, migration-inducing gene 16 protein, neurotrophic tyrosine kinase receptor related 3, Neurotrophic tyrosine kinase, receptor-related 3, NTRKR3cell migration-inducing protein 20, Receptor protein-tyrosine kinase TKT, TKTMIG20a, TYRO10, Tyrosine-protein kinase TYRO10, tyrosylprotein kinase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
4921
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
DDR2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- DDR2 Polyclonal specifically detects DDR2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: DDR2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CD167 antigen-like family member B, CD167b antigen, Discoidin domain receptor 2, discoidin domain receptor family, member 2, discoidin domain receptor tyrosine kinase 2, discoidin domain-containing receptor 2, EC 2.7.10, EC 2.7.10.1, hydroxyaryl-protein kinase, migration-inducing gene 16 protein, neurotrophic tyrosine kinase receptor related 3, Neurotrophic tyrosine kinase, receptor-related 3, NTRKR3cell migration-inducing protein 20, Receptor protein-tyrosine kinase TKT, TKTMIG20a, TYRO10, Tyrosine-protein kinase TYRO10, tyrosylprotein kinase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 4921
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DDR2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: CD167 antigen-like family member B, CD167b antigen, Discoidin domain receptor 2, discoidin domain receptor family, member 2, discoidin domain receptor tyrosine kinase 2, discoidin domain-containing receptor 2, EC 2.7.10, EC 2.7.10.1, hydroxyaryl-protein k
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 4921
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: cysteine/histidine-rich 1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CHRP, cysteine and histidine rich 1, cysteine and histidine-rich protein 1, cysteine/histidine-rich 1, KIAA0496cysteine and histidine rich protein, MGC13010
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 50626
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% with 0.02% Sodium Azide
Gene Symbols: CYHR1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.