PABPC1L Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255978-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP255978 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PABPC1L
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
80336
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PABPC1L
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Description
- Description PABPC1L Polyclonal specifically detects PABPC1L in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PABPC1L
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 80336
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PABPC1L
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 80336
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: GRAP
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: GRB2-related adapter protein, GRB2-related adaptor protein, growth factor receptor-bound protein 2-related adaptor protein, MGC64880
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10750
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GRAP
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MESVALYSFQATESDELAFNKGDTLKI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.