SHC3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256058-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256058 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SHC3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transforming protein C, src homology 2 domain-containing transforming protein C3, Src homology 2 domain-containing-transforming protein C3
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
53358
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SHC3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description SHC3 Polyclonal specifically detects SHC3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SHC3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transforming protein C, src homology 2 domain-containing transforming protein C3, Src homology 2 domain-containing-transforming protein C3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 53358
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SHC3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transform
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 53358
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: ITGB1BP3
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias: EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 27231
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NMRK2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.