ALG6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256400-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256400 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ALG6
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 6 homolog (S. cerevisiae, asparagine-linked glycosylation 6 homolog (yeast, asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 6 homolog, CDG1C, dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase, EC 2.4.1, EC 2.4.1.-, Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
29929
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ALG6
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ALG6 Polyclonal specifically detects ALG6 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ALG6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 6 homolog (S. cerevisiae, asparagine-linked glycosylation 6 homolog (yeast, asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 6 homolog, CDG1C, dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase, dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase, EC 2.4.1, EC 2.4.1.-, Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 29929
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ALG6
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: alpha-1,3-glucosyltransferase), asparagine-linked glycosylation 6 homolog (S. cerevisiae, asparagine-linked glycosylation 6 homolog (yeast, asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosyl
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 29929
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: LUC7L
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: FLJ10231, hLuc7B1, Luc7, LUC7 (S. cerevisiae)-like, LUC7B1, LUC7L1, LUC7-LIKE, LUC7-like (S. cerevisiae), putative RNA-binding protein Luc7-like 1, Putative SR protein LUC7B1, sarcoplasmic reticulum protein LUC7B1, SR+89
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55692
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: LUC7L
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPDWRLESSNGKMASRRSEEKEAGEI
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.