Exostosin-like 2/EXTL2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256467-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256467 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Exostosin-like 2/EXTL2
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, alpha-1,4-N-acteylhexosaminyltransferase, Alpha-GalNAcT EXTL2, EC 2.4.1.223, exostoses (multiple)-like 2, exostosin-like 2, EXTR2, EXT-related protein 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, processed exostosin-like 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
EXTL2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM
Quantity
100 μL
Research Discipline
Stem Cell Markers
Gene ID (Entrez)
2135
Target Species
Human
Isotype
IgG
Related Products
Description
- Exostosin-like 2/EXTL2 Polyclonal specifically detects Exostosin-like 2/EXTL2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Exostosin-like 2/EXTL2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Alpha-1,4-N-acetylhexosaminyltransferase EXTL2, alpha-1,4-N-acteylhexosaminyltransferase, Alpha-GalNAcT EXTL2, EC 2.4.1.223, exostoses (multiple)-like 2, exostosin-like 2, EXTR2, EXT-related protein 2, Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, processed exostosin-like 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: EXTL2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM
Quantity: 100 μL
Research Discipline: Stem Cell Markers
Gene ID (Entrez): 2135
Target Species: Human
Isotype: IgG
Antigen: FBXO27
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Fbg5, FBG5FBX27, F-box only protein 27, F-box protein 27, F-box protein FBG5, F-box/G-domain protein 5, Fbx27
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FBXO27
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDG
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 126433
Target Species: Human
Isotype: IgG
Antigen: DMRTA1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DMO, DMRT-like family A1, doublesex- and mab-3-related transcription factor A1, MGC163307, MGC163309
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DMRTA1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VPTLPFRPALDYAFSGMIRDSSYLSSKDSITCGRLYFRPN
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 63951
Target Species: Human
Isotype: IgG
