RNF34 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256413-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256413 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
RNF34
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation
Gene Alias
CARP1, Caspase regulator CARP1, Caspases-8 and -10-associated RING finger protein 1, E3 ubiquitin-protein ligase RNF34, EC 6.3.2, EC 6.3.2.-, FLJ21786, FYVE-RING finger protein Momo, hRFI, Human RING finger homologous to inhibitor of apoptosis protein, RFI, RIF, RIFF, ring finger protein 34CARP-1, RING finger protein RIFF
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
RNF34
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
Quantity
100 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
80196
Target Species
Human
Isotype
IgG
Related Products
Description
- RNF34 Polyclonal specifically detects RNF34 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Immunoprecipitation.
Compare Similar Items
Show Difference
Antigen: RNF34
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation
Gene Alias: CARP1, Caspase regulator CARP1, Caspases-8 and -10-associated RING finger protein 1, E3 ubiquitin-protein ligase RNF34, EC 6.3.2, EC 6.3.2.-, FLJ21786, FYVE-RING finger protein Momo, hRFI, Human RING finger homologous to inhibitor of apoptosis protein, RFI, RIF, RIFF, ring finger protein 34CARP-1, RING finger protein RIFF
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RNF34
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 80196
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: CARP1, Caspase regulator CARP1, Caspases-8 and -10-associated RING finger protein 1, E3 ubiquitin-protein ligase RNF34, EC 6.3.2, EC 6.3.2.-, FLJ21786, FYVE-RING finger protein Momo, hRFI, Human RING finger homologous to inhibitor of apoptosis protein, RF
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 80196
Target Species: __
Isotype: __
Antigen: PALM2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: A kinase (PRKA) anchor protein 2, AKAP2, AKAPKL, KIAA0920, paralemmin 2, paralemmin-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PALM2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TKVVYEVRSGGTVVENGVHKLSTKDVEELIQKAGQSSLGGGHVSERTVIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQ
Quantity: 100 μL
Research Discipline: Protein Kinase
Gene ID (Entrez): 114299
Target Species: Human
Isotype: IgG