PTPRB Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256421-Each-of-1 | In Stock | ₹ 52,277.16 |
NBP256421 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 52,277.16
GST (18%): ₹ 9,409.889
Total Price: ₹ 61,687.049
Antigen
PTPRB
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
DKFZp686E2262, DKFZp686H15164, EC 3.1.3.48, FLJ44133, HPTPB, HPTP-BETA, MGC142023, MGC59935, protein tyrosine phosphatase, receptor type, B, protein tyrosine phosphatase, receptor type, beta polypeptide, Protein-tyrosine phosphatase beta, PTPB, receptor-type tyrosine-protein phosphatase beta, R-PTP-BETA, Vascular endothelial protein tyrosine phosphatase, VEPTP, VE-PTP
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
5787
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PTPRB
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSD
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- Description PTPRB Polyclonal specifically detects PTPRB in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PTPRB
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: DKFZp686E2262, DKFZp686H15164, EC 3.1.3.48, FLJ44133, HPTPB, HPTP-BETA, MGC142023, MGC59935, protein tyrosine phosphatase, receptor type, B, protein tyrosine phosphatase, receptor type, beta polypeptide, Protein-tyrosine phosphatase beta, PTPB, receptor-type tyrosine-protein phosphatase beta, R-PTP-BETA, Vascular endothelial protein tyrosine phosphatase, VEPTP, VE-PTP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 5787
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PTPRB
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HPLPSYLEYRHNASIRVYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSD
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp686E2262, DKFZp686H15164, EC 3.1.3.48, FLJ44133, HPTPB, HPTP-BETA, MGC142023, MGC59935, protein tyrosine phosphatase, receptor type, B, protein tyrosine phosphatase, receptor type, beta polypeptide, Protein-tyrosine phosphatase beta, PTPB, receptor-t
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 5787
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: JPH3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CAGL237, junctophilin 3, junctophilin type 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 57338
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: JPH3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF',)
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
