RECK Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257738-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257738 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
RECK
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs), suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs), Suppressor of tumorigenicity 15 protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
RECK
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
Quantity
100 μL
Research Discipline
Cell Cycle and Replication
Gene ID (Entrez)
8434
Target Species
Human
Isotype
IgG
Related Products
Description
- RECK Polyclonal specifically detects RECK in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: RECK
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs), suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs), Suppressor of tumorigenicity 15 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RECK
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication
Gene ID (Entrez): 8434
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 8434
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: MGC138448, NFAT transcription complex cytosolic component, NFAT2cytoplasmic 1, NFATC, NF-ATC, NFATc1, NF-ATc1, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 4772
Target Species: __
Isotype: __
