SPTLC1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256477-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP256477 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
SPTLC1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serine-palmitoyl-CoA transferase 1, SPT 1, SPT1HSN1, SPTI
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10558
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SPTLC1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SPTLC1 Polyclonal specifically detects SPTLC1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SPTLC1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serine-palmitoyl-CoA transferase 1, SPT 1, SPT1HSN1, SPTI
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10558
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SPTLC1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serin
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 10558
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: Smek1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLFL1, FLJ20707, KIAA2010MSTP033, PP4R3A, PPP4R3A, serine/threonine-protein phosphatase 4 regulatory subunit 3A, SMEK homolog 1, SMEK homolog 1, suppressor of mek1 (Dictyostelium), smk1, smk-1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 55671
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PPP4R3A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDME
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.