RIMS2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256512-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256512 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
RIMS2
Classification
Polyclonal
Dilution
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias
DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3IP3, regulating synaptic membrane exocytosis 2, regulating synaptic membrane exocytosis protein 2, RIM 2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
9699
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
RIMS2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- RIMS2 Polyclonal specifically detects RIMS2 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: RIMS2
Classification: Polyclonal
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3IP3, regulating synaptic membrane exocytosis 2, regulating synaptic membrane exocytosis protein 2, RIM 2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9699
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RIMS2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3I
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 9699
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: Somatostatin R5/SSTR5
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: somatostatin receptor 5, somatostatin receptor subtype 5, somatostatin receptor type 5, SS5R, SS-5-R, SS5-R
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6755
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SSTR5
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLV
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.