Proteasome 19S S7 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256743-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256743 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Proteasome 19S S7
Classification
Polyclonal
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, MGC3004, MSS1ATPase, 2, proteasome (prosome, macropain) 26S subunit, ATPase, 2, Protein MSS1, putative protein product of Nbla10058
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
PSMC2
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV
Quantity
100 μL
Research Discipline
Neuroscience, Ubiquitin Proteasome Pathway
Gene ID (Entrez)
5701
Target Species
Human
Isotype
IgG
Related Products
Description
- Proteasome 19S S7 Polyclonal specifically detects Proteasome 19S S7 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Proteasome 19S S7
Classification: Polyclonal
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: 26S protease regulatory subunit 7, 26S proteasome AAA-ATPase subunit RPT1, MGC3004, MSS1ATPase, 2, proteasome (prosome, macropain) 26S subunit, ATPase, 2, Protein MSS1, putative protein product of Nbla10058
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PSMC2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQV
Quantity: 100 μL
Research Discipline: Neuroscience, Ubiquitin Proteasome Pathway
Gene ID (Entrez): 5701
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1737
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: C32CKLF2, chemokine-like factor, chemokine-like factor 1, chemokine-like factor 2, chemokine-like factor 3, chemokine-like factor 4, CKLF1, CKLF3, CKLF4, HSPC224, transmembrane proteolipid, UCK-1
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 51192
Target Species: __
Isotype: __
