PIMT Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256790-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256790 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
PIMT
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Cap-specific guanine-N2 methyltransferase, CLL-associated antigen KW-2, DKFZp762A163, EC 2.1.1, EC 2.1.1.-, HCA137, Hepatocellular carcinoma-associated antigen 137, NCOA6IPSEREX-defined, nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIMTFLJ22995, PIPMT, PRIP-interacting protein PIPMT, PRIP-interacting protein with methyltransferase domain, PRIP-interacting protein with methyltransferase motif, trimethylguanosine synthase, trimethylguanosine synthase 1, trimethylguanosine synthase homolog, trimethylguanosine synthase homolog (S. cerevisiae)
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TGS1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD
Quantity
100 μL
Research Discipline
Transcription Factors and Regulators
Gene ID (Entrez)
96764
Target Species
Human
Isotype
IgG
Related Products
Description
- PIMT Polyclonal specifically detects PIMT in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: PIMT
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Cap-specific guanine-N2 methyltransferase, CLL-associated antigen KW-2, DKFZp762A163, EC 2.1.1, EC 2.1.1.-, HCA137, Hepatocellular carcinoma-associated antigen 137, NCOA6IPSEREX-defined, nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIMTFLJ22995, PIPMT, PRIP-interacting protein PIPMT, PRIP-interacting protein with methyltransferase domain, PRIP-interacting protein with methyltransferase motif, trimethylguanosine synthase, trimethylguanosine synthase 1, trimethylguanosine synthase homolog, trimethylguanosine synthase homolog (S. cerevisiae)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TGS1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD
Quantity: 100 μL
Research Discipline: Transcription Factors and Regulators
Gene ID (Entrez): 96764
Target Species: Human
Isotype: IgG
Antigen: PKNOX2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: homeobox protein PKNOX2, PBX/knFLJ13074, PBX/knPREP2Homeobox protein PREP-2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PKNOX2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DASNPDPAPKAKKIKSQHRPTQRFWPNSIAAGVLQQQGGAPGTNPDGSINLDNLQSLS
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 63876
Target Species: Human
Isotype: IgG
Antigen: MafF
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: hMafF, transcription factor MafF, U-Maf, v-maf avian musculoaponeurotic fibrosarcoma oncogene family protein F, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein F, V-maf musculoaponeurotic fibrosarcoma oncogene homolog F, v-maf musculoaponeurotic fibrosarcoma oncogene homolog F (avian)
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MAFF
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSSKALKIKRELSENTPHLSDEALMGLSVREL
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 23764
Target Species: Human
Isotype: IgG
