Adenylate Kinase 6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256093-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP256093 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
Adenylate Kinase 6
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
AD-004, Adenylate kinase isoenzyme 6, adrenal gland protein AD-004, AK/ATPase, AK6, ATP-AMP transphosphorylase 6, CGI-137, CINAP, CIP, coilin interacting nuclear ATPase protein, coilin interacting protein, Coilin-interacting nuclear ATPase protein, Dual activity adenylate kinase/ATPase, EC=2.7.4.3, hCINAP
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
AK6
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE
Quantity
100 μL
Primary or Secondary
Primary
Target Species
Human
Isotype
IgG
Related Products
Description
- Adenylate Kinase 6 Polyclonal specifically detects Adenylate Kinase 6 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Adenylate Kinase 6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: AD-004, Adenylate kinase isoenzyme 6, adrenal gland protein AD-004, AK/ATPase, AK6, ATP-AMP transphosphorylase 6, CGI-137, CINAP, CIP, coilin interacting nuclear ATPase protein, coilin interacting protein, Coilin-interacting nuclear ATPase protein, Dual activity adenylate kinase/ATPase, EC=2.7.4.3, hCINAP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: AK6
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Target Species: __
Isotype: __
Antigen: PERQ2
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GIGYF2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK
Quantity: 100 μL
Primary or Secondary: Primary
Target Species: Human
Isotype: IgG