Rab3D Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256973-Each-of-1 | In Stock | ₹ 52,277.16 |
NBP256973 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 52,277.16
GST (18%): ₹ 9,409.889
Total Price: ₹ 61,687.049
Antigen
Rab3D
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
RAB3D
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Quantity
100 μL
Research Discipline
Membrane Trafficking and Chaperones, Signal Transduction
Gene ID (Entrez)
9545
Target Species
Human
Isotype
IgG
Related Products
Description
- Rab3D Polyclonal specifically detects Rab3D in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: Rab3D
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RAB3D
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Quantity: 100 μL
Research Discipline: Membrane Trafficking and Chaperones, Signal Transduction
Gene ID (Entrez): 9545
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9545
Target Species: __
Isotype: __
Antigen: PHLDB1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FLJ00141, LL5alpha, pleckstrin homology-like domain, family B, member 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: PHLDB1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPVPAESESLVNGNHT
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 23187
Target Species: Human
Isotype: IgG