SMARCD3 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257036-Each-of-1 | In Stock | ₹ 53,988.36 |
NBP257036 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,988.36
GST (18%): ₹ 9,717.905
Total Price: ₹ 63,706.265
Antigen
SMARCD3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
6604
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SMARCD3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLK
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SMARCD3 Polyclonal specifically detects SMARCD3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SMARCD3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 6604
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SMARCD3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLK
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010,
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 6604
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: CPSF4
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 30kD, cleavage and polyadenylation specific factor 4, 30kD subunit, cleavage and polyadenylation specific factor 4, 30kDa, CPSF 30 kDa subunit, Neb-1, No arches homolog, no arches-like zinc finger protein, NS1 effector domain-binding protein 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10898
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CPSF4
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQ
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
