SRRM1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257064-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP257064 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SRRM1
Classification
Polyclonal
Dilution
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockdown Validated
Gene Alias
MGC39488, POP101, Ser/Arg-related nuclear matrix protein, serine/arginine repetitive matrix 1, serine/arginine repetitive matrix protein 1, SRm160, SRM160160-KD, SR-related nuclear matrix protein of 160 kDa
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
10250
Target Species
Human
Isotype
IgG
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
SRRM1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVS
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SRRM1 Polyclonal specifically detects SRRM1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.
Compare Similar Items
Show Difference
Antigen: SRRM1
Classification: Polyclonal
Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockdown Validated
Gene Alias: MGC39488, POP101, Ser/Arg-related nuclear matrix protein, serine/arginine repetitive matrix 1, serine/arginine repetitive matrix protein 1, SRm160, SRM160160-KD, SR-related nuclear matrix protein of 160 kDa
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 10250
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: SRRM1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVS
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: leucine zipper and CTNNBIP1 domain containing, Leucine zipper and CTNNBIP1 domain-containing protein, Leucine zipper and ICAT homologous domain-containing protein, leucine zipper domain and ICAT homologous domain containing, MGC15436, protein LZIC
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 84328
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: FN3K
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.7.1.-, fructosamine 3 kinase, fructosamine-3-kinase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 64122
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FN3K
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIPQVNEWQDDWPTFFARHRLQAQLDLIEKDYADREARE
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.